TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q3JL26|BIPD_BURP1 Translocator protein BipD OS=Burkholderia pseudomallei (strain 1710b) GN=bipD PE=3 SV=2
MNMHVDMGRALTVRDWPALEALAKTMPADAGARAMTDDDLRAAGVDRRVPEQKLGAAIDEFASLRLPDRIDGRFVDGRRA
NLTVFDDARVAVRGHARAQRNLLERLETELLGGTLDTAGDEGGIQPDPILQGLVDVIGQGKSDIDAYATIVEGLTKYFQS
VADVMSKLQDYISAKDDKNMKIDGGKIKALIQQVIDHLPTMQLPKGADIARWRKELGDAVSISDSGVVTINPDKLIKMRD
SLPPDGTVWDTARYQAWNTAFSGQKDNIQNDVQTLVEKYSHQNSNFDNLVKVLSGAISTLTDTAKSYLQI