TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q3MIR4|CC50B_HUMAN Cell cycle control protein 50B OS=Homo sapiens GN=TMEM30B PE=2 SV=1
MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGDPGTGNCSVCA
AAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGLPIA
PCGAIANSLFNDSFSLWHQRQPGGPYVEVPLDRSGIAWWTDYHVKFRNPPLVNGSLALAFQGTAPPPNWRRPVYELSPDP
NNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPRGAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNPFLGIA
YLVVGSLCILTGFVMLVVYIRYQDQDDDDEE