TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q3SQ15|Q3SQ15_NITWN Putative uncharacterized protein OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=Nwi_2372 PE=4 SV=1
MNTTTRLSTLLLSTAAFVAVACGASLAADENSLQHRLAQLERENATLTRENAALRLNRKLARENVALRKSSPERAAPAAA
PSPGTSVRDAYAADFPVAYKALPVETQGQFRFWGEGGAIWSGGDPVTTPYSLRGFSSDLNFGFGAAGGPPNRLFNLTPKV
GWEAAAGFDYRFAGSPWHVSGEFRYGQARGSGADASAGTIDPAVLALLAAANPVFAGVAIGGSQTIAASHREDRWQADIA
LGYDALGGPPMPCRSRAACVSPNWSGARPSSIEAKPTCGFQRRWISASAYRSRALITARRRP