TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q3UBX0|TM109_MOUSE Transmembrane protein 109 OS=Mus musculus GN=Tmem109 PE=1 SV=2
MAGAHSTPLWSRHLLKAVLMVLVALFLVHSASAQSHREFASPGQQKKETSADILTQIGRSLKEMLDTWLGPETMHVISET
LLQVMWAISSAISVACFALSGIAAQLLSALGLDGEQLTQGLKLSPSQVQTLLLWGAAALVIYWLLSLLLGLVLALLGRIL
GGLKLVLFVAGFVALVRSVPDPSTRALMLLALLTLFALLSRLTGSRSSGSHLEAKVRGLERQIEELRGRQRRAAKMPRSM
EEE