TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q3V050|S47A2_MOUSE Multidrug and toxin extrusion protein 2 OS=Mus musculus GN=Slc47a2 PE=1 SV=1
MEPAEDSLGATIQPPELVRVPRGRSLRILLGLRGALSPDVRREAAALVALAGPVFLAQLMIFLISIVSSIFCGHLGKVEL
DAVTLAVSVVNVTGISVGTGLASACDTLMSQSFGGKNLKRVGVILQRGILILLLCCFPCWAIFLNTERLLLLLRQDPDVA
RLAQVYVMICIPALPAAFLFQLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALL
FLYVWWKRIHIHTWGGWTRECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTELGAQAVIYELASVAYMVPFG
FGVAASVRVGNALGAGNADQARCSCTTVLLCAGVCALLVGILLAALKDVVAYIFTNDKDIISLVSQVMPIFAPFHLFDAL
AGTCGGVLRGTGKQKIGAVLNTIGYYGFGFPIGVSLMFAAKLGIIGLWAGLIVCVSFQAFSYLIYILRTNWSRVAEQAQV
RAGLKSTKELIPTPADLPILEREVMDGVILPDIIRPESQTGQLVVEENSQCAVPTVGEVLTGRQLVFYRGMALTVSVAVL
IAGIVVRVFNDRG