TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q42374|SY111_ARATH Syntaxin-related protein KNOLLE OS=Arabidopsis thaliana GN=KN PE=1 SV=1
MNDLMTKSFMSYVDLKKAAMKDMEAGPDFDLEMASTKADKMDENLSSFLEEAEYVKAEMGLISETLARIEQYHEESKGVH
KAESVKSLRNKISNEIVSGLRKAKSIKSKLEEMDKANKEIKRLSGTPVYRSRTAVTNGLRKKLKEVMMEFQGLRQKMMSE
YKETVERRYFTVTGEHANDEMIEKIITDNAGGEEFLTRAIQEHGKGKVLETVVEIQDRYDAAKEIEKSLLELHQVFLDMA
VMVESQGEQMDEIEHHVINASHYVADGANELKTAKSHQRNSRKWMCIGIIVLLLIILIVVIPIITSFSSS