TCDB is operated by the Saier Lab Bioinformatics Group
>Q45411|EPSE2_RALSO EPS I polysaccharide export inner membrane protein epsE - Ralstonia solanacearum (Pseudomonas solanacearum).
MQKTAPRPLPARISFLSASVLGLGAAVASRGAVFVSNILLAHSLTVHDFGLFSYAYVTALNLGLFLATGVSQAAGHVLPL
IENPERKRTQLCAFIVLLMALIAVAAAALYLSSASISVAAFGSEQGSGALRMAAIVLIATAFTQALQSFQYAMHEHRSSA
TISIGAAVLLLTMLWAMGPIRQPALALTIFLAVNAGAAVSQLLVLARATPSQRGPWRTGREELRLAVKHALPSVLTTSMG
APVHWICLSMLAAMTDGAHQLALFSVAFQWYIAITFIPATLGNLALPFLARHAGATETTVRQRFRSALLFGGGLSLALGC
ASFLLAGEIFAWFYPAEYGSAASSMRSLSVAAALCGVSVLLQQRIAAAGKFWRNFAMAAVYSVIYVAASYLALRLGFGAT
SIGLAMSAAYCCLILFQTLTLQGDSGAAIRLGRSFS