TCDB is operated by the Saier Lab Bioinformatics Group
>Q45592|Q45592_BACSU YydJ protein - Bacillus subtilis.
MKLEFKKSISNKVIIILGAMFVFLFLLGYFLLVGIDKVSNVTPEMFFFSSYTVATQFGLMLFSFVIAFFINREYSNKNIL
FYKLIGENIYTFFYKKIAVLFLECFAFITLGLLIISLMYHDFSHFALLLFLFSAVILQYILIIGTISVLCPNILISIGVS
IVYWMTSVILVAISNKTFGFIAPFEAGNTMYPRIERVLQSDNMTLGSNDVLFIILYLVSIIIINAIVLRFSKTRWIKMGL