TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q467F4|Q467F4_METBF ATP synthase F0 subcomplex C subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) OX=269797 GN=Mbar_A3101 PE=3 SV=1
MALDTYITTIAVASIATAGITIGIGVIGPAIGEGRAVATALSSLAQQPDASATITRTLFVGLAMIESLAIYCFVVSMILI
FANPFWNRALT