TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q47877|YHLA_EDWTA HYPOTHETICAL 34.8 KDA PROTEIN IN HLYA 3'REGION - Edwardsiella tarda.
MNAYSYMLIKNPDVNFEGITINGYVDLPGRIVQDQKNARSHAVTWDTKVKKQLLDTLNGIVEYDTTFDNYYETMVEAINT
GDGETLKEGITDLRGEIQQNQKYAQQLIEELTKLRDSIGHDVRAFGSNKELLQSILKNQGADVDADQKRLEEVLGSVNYY
KQLESDGFNVMKGAILGLPIIGGIIVGVARDNLGKLEPLLAELRQTVDYKVTLNRVVGVAYSNINEIDKALDDAINALTY
MSTQWHDLDSQYSGVLGHIENAAQKADQNKFKFLKPNLNAAKDSWKTLRTDAVTLKEGIKELKVETVTPQK