TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q48237|Q48237_HELMU Major ring-forming surface antigen precursor - Helicobacter mustelae.
MTKISDVQEKNFLKRKEKSSSLRNRKFFQPLIATTLAFSLASSFVNAADAGNAGQAPVNAEGITVTVNQANKTATVSGNN
GNATFTFTNGANTTVNGTADPAVTAPNIEVNIANTVNNFTVDGKPANQANQNLGAEGKPVNLNFDFGGIASSGTAKTFTL
NLGGAGNANALTGNLNILGAGNATLNTNTNGSIASGGPVINVNKDATFNATFSGGATMTGNIVTGNTKETSGTGTNNITF
DGPKQIPHNGSLIKDGTAVTGQADPATVLTGNISTYGGINNVTFEKGTMKGDIIAGNATGQSLGMNVVTFKEQGVHYTGN
VIASGTGGVNNTLNFGNATVDATNGGNTLIIQNSGITFNNTNGVNNSPTLTHATITPAAAGGDPANQATVFQGNIKSAYQ
GVNTLNFYNFAKLEGTPANKANPAPAANITATNNGANNIVFTDGGLVNANLTSTLDQGINTLVMNTNNIVTNPILLTGNV
VTNTPGWAGSNTLLFQNNGTSSTGGNAMQTLTNQVAYVGNIVANGGSVQAIFSNTYWAPTNLKDLKEQAGGLNAAGAAGA
NARANAQAKSQQIQGYLDKFNGNSANATGNLTATNGGTATLVLRNTTTLANLPRQAAQYNVTVGGNNSSANIVLEAPVNA
SATITYGGYYLGGNGTSNYVWNGSQNTSSVNLIFANADNRGTPTLNGATGSSTLVSDAFGGQFRNDLGAGKVLGVTYQNG
IQMSLSDKNVTLQGQNGLYSGSFMAFFKDAILAKIAKVDSNAEFATQGIPLNVSLVKSGNGTSSPGSGGNSFVNNITLEG
VAVGSITALTNKQATGTNGMNNTSGIVNLVLKSDSVLLGTIAGENQKGLTMNMQLNQGAKLILQNSGAGTGGDVALNNLT
IASGNNGNGNNGAAVTFQGGSVSFDKNQANDYTALQNNTVIDLATGGGSNNVPSRTWFNLLTVGQANSSNTTTASDGQQA
SGLGGNNALFKVYVNADANQGNGAGGGRGNATLNGQNSFNGSGLYGNIYSDRVIVYQTQEQHFCDRISPNPRQWKSYGVR
YHGGGTERAGNVAVATVKNEGGQASVNFTTVGSVIGFDVFDAKLTAVKTNAYGKVETNNANNAGNSTPAPGLGSIPGLGG
TGGTSSGNGTGGSQDQANAQDYTTYFISQAVANTSEANQLATATALASNYYLYLANIDSLNKRMGELRSNPRSNGFWMRM
FNGMQTTKFALQTTSIYTTVQAGWDHVFGSEGGNDFLGFAVAYAGAAMSSEKKEQLVNGAQKGVKSSGGNAFEISLYNSY
VQDGAASSTDFKYGFYSDSVAKFSFLWNKLTMFGEDSSPNMQNFGFTFSQEIGYRFLLGNHNEWYITPQGQVALGYFNQS
NIKQTLGSHWLKGEQSSIFTVQGRIGSNFGYRFNQFTEDKGWASELYLGLWYIGDYISGGNLTLVSDLGSVNTLRTLSST
GRFAFNIGTNFVVKDNHRFYFDFERSFGGKIITDYQFNIGYRYNFGENRKYVSLLAGSMKDTIKKDDKKENKEETEEIE