TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q48546 Integral outer membrane protein - Leptospira kirschneri.
MIRNISKALLILAVALSSAASLSAKTYAIVGFGLQLDLGQLGGTITKDGLDAASYYGPVRSTDTCTVGPNDPTCVQNPGK
PAGEGNYLGVAPRKAIPAENKLITLDRTTGGLINARSTKGAMVGGNLMVGYESDFGKYFFWRVAAEYTQKISGGITKADI
AGYSIVDMTWGFSSIVIPATVGIKLNVTEDAAVYMGAGLNYFNGWWSLNGSNNLKGGHDILAAAGAGSVANLIADGTDPI
TTREHVRFRTSGIAPNFLIGTQARVTDKGHVFLELETIMSAAYAVGKTQSAGGATNLSPFPAYPIVVGGQIYRFGYKHEL