TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4DXU9|Q4DXU9_TRYCC Uncharacterized protein OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053510719.80 PE=4 SV=1
MIMAVERQCVDSFAYFLYAFNTFHLCLCLCCTRNAHLFFFSCNDSFTLFMRVYLFVMVIAFFFVFIFFWGIVLLVFSIKL
GLAKMIHPFALVFSGLLTSSAMLGGHLPAAVLLIYMMLLRNPKCATSPIVLVLAFLFAVLQLLSTLIVNLLVAFSPSTRG
GLFVHHRVLIESFGIYEAGPGVKAWILAGACVPSGLICVYIIYFRKKLLSRISMGRVRPLLTTVSWALMSVATGLIFPTV
LAGVLLVIGMMALSCVGLGGARTIFGAARSRPRRFLLLFLHFCSLCGTFASCIILVASCVSQNAAVACALDNLDPMYGLN
KLYEQPADIAICRFVQLCLMMVTLFLAQMAMECHGKELQQQNAGDPLLREEVSNNNARVVEGTQGTSVAVVFNHADVPSA
PNFASAAVPSHSNHHLSRPLNVPHGLSLAGHSSPNSSAAFGTNYLERGLVVCGSLGTWMMRKLFASSRMLPLAFMAANMV
AFPSVVSLSLLPTMMLGQLVRFHFFASLLRPTLVLNFFLVNVQYVVLATASIQPPIVRHLFLGDEGRWWGLAQVISSEII
FLAMLAADAAIRQQYRLAHSEEDHPDEIVVPHPPPLPSIAPSSPTASHVTREFVALSDGKDSSSESGGDTSLDFLGIWRH
AEFKLGARRVAELLAYVPSEPLESSEAFEQLFSFLVGRRPTAEEEKCLCKEGIGDALLREKLHDSQSPLLSYYVHWAGIL
LMRHAVLIALLLLFIVGSFTYQMDILHAIVLLLFVLYFFLPDSMDDAWMFVVIYLMLLTSFKLIFTFVSEFVTLSVYIAG
SPLQYATVGLVPLRSRYEAIPYVVAVFILTFLFLRIRVCRSWGTAVSLHEWDRFCHSNTARQWSMRVTMTVATTVFVALG
VFLHYSFIVEGFLALFLLLTISAAAFSLSGAFLGVLWSVACVYSGIVVVVTSVCQFTQLADLIREHVFQRLCGHDGDGSG
NSTNARRCEQESGLYPVREDMPLTLFLAPWFLAFATAMLHRAVKHVRETPPRWARQPDGSGGLVGMTVEQQEEQPKRGEQ
SEGEQRVVPVECVSLPCLESDDQRFIRHMLRLLAVMDKLGDWIAAFGSDYGGILVWVSLFLAATYRFTAIGSVYMLFFLL
DLTHISVLVYCVLHILVLYTYKFSFVPEITYSIYNVPLAAVIGLEKKGGNALFEHVIGPVIVFFVMLLRIHTCGANREVR
RRQRTEGPESSNWKSVLCTQLFFYAGYEGLVLTLLLVLACSSHSCIGAFVGLAVLPLLLATGRQQLHRVSYSFPLLLLLS
LMVLWQYALLLNAAHRLFPAIADYSEAKETDGMWEYWVFTSRYHTLLGCVLGIMLLHTSRQQSGDTAVSFSMLRSQFNGH
VTLVNFVRAASVGSLQLLPRDTFDLVVPSFVESLPPSCLGRVTTFMVFAVSYLCPVAFLSFAAGVMSQPSVINLLLIIGG
LLQVAQMEMLHWTFFSLWPFITMAYWFLITLTVVCNAPYVRQFILEHYGLSEVLGLLQAGKPFQLGSLHVLLLFMVTLQT
RVYDEFRYTKLLRHLYDRTATRHTRHEELWAWLRGKQEAEQQLADARSRALHAKLEEIRSTLHGAHHAWVPEDSSTQKCS
ANAVTNSQQLKDEKMMMMMARQRIADDDDDTAARLKREEEEEEEEKEERSAKGSMLTDDKVKVSKKKSEKGGTCAHKFKT
GLQRIIHVSATKLANWLAVHTYEPHRHTAAHYRGLFSRLFWVTIRALERHTVMVVLLATMINFMLSQCVWELLPFCFMLV
VAIAYHPFPPRPIFVFFSFYVALGILLKALIDVVLAQVSYSPGLLKILGWTILHVSEGAYWKQRIGYSYVMMDFVVFATL
LLHQDICLANGVYSRKDILRSREGEQAAGNTKGTNNDPLPPPSPSSSVPAIYSPSSFGDAASGTEQLPAGRSPMEDPIRR
SRTSCMMGIYRKVCLAVLGFVRNATSIPGVGRDWYIYYSTVEAIALLVFVFGYNKLSGWVEDTLQESVKRNLLPGPMVTV
VLVSILYMIADRMLYVTQCMKGKLLLNTVTGVAYCILYMLWGNLLTVSSRVVGNLFFTLKILALTIAVIQVRVGYPRHRR
HDPFTWTAGRSGIAGYLYFWYRCLPFLWEIRVVTDWTVEKTSLHLDNYLKIEDLYDIVFERQCKLYNVCKQRQALGTPIP
RSTKVTAGLSRLVLFVGALMVPLVYYSTFNPSMQSNEVTQLRVGLSFMSSQPFYASTTFTAEEIPNEWSLWLARTRPSLD
RNGIMNTKKTLQLVNVSSCSNELWPISPQAYGRLNEQLMEVMENKTTMQLFQTIELSRSGTSNFVSHTQSWTFSWEAARD
IHRMLNNPTTNGTGYVKLQNFYTPFLFSHPDGLAAFDGGGGVNVMDCSILLRQEVDSVLNNTVRYWCVECQSLFTHGNIP
NSNKTRFPEWGCLSTGEGCSKFNFERRNGDVNYNPVPMYFVVLSDPSVGGVPFLQGIGIVALYTTFVLALGRIFRGMFAN
KAKYTILSDMADPTPIAQLIEYITVARECGDLPLEQSVYIELVDLLRSPERLLRLTGFNRQMYDAETDVIQSPHATPSNR
MTENLSHRGDALRGPEAGIAPADDAKREVNAAGHEKKE