TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4E330|Q4E330_TRYCC Putative uncharacterized protein OS=Trypanosoma cruzi (strain CL Brener) GN=Tc00.1047053506435.20 PE=4 SV=1
MPWSHGLSRPFTPHLQCVILSIVYLHSLFIPALLGQSIIATLLLVLNLVCAVRYENHRWRHLTLHSSDNWNDAISARLIP
VRKVSLLSFLLPSQLLLYVSLVFSCLQLFLAATLGWLLGLSFMQQGWPKAVLNSLGVWGRKDVLPLVVNVVSSTLLAVSS
ASLCFLLRKHQFQPSTEPNRLFHRSSLLCLALLAPVTASLYPTYDCTPLFVVHFLCIMSFSISSFPVLRVRLLEVATKGC
TVVSLLLLAGGLLAQSPVVQQIVLEHGEPIDAWSIMRYECDWAKIFKSSAVFRRGAQFLLLSYTIVASRYVHGSWRRISR
RELEEHREYFYEPPFLLWQLFSVRYPARLRKIQQFMGYYLPLAVFPLMIIMSFMVMDLVSILMVITTLFGFLLPSDTYVV
LLPFCYGAIALGIVLEFVATVDSRLQQPFFMVYAATGVTAFMIRLAQCFVNSLLILAVCMFRVNPIQGQYRSLAEKKAQI
RMAFNHLQNRLDEIQCIFKRVCNGTTGTVNRDGFPELLKQVLPTSRIREKEIDSLWRFLTEGEPVLLQTTPQVTPRINKA
TLEFAGNADAVRNPLSHLSSALHGGRRASTSREESNGNRDDNDEKGEDMDLEAWKEIKNGLDSSSCMGALEIKSPSREEE
KSLEAASTTISFWDVSSGEDQFRRGEHKNGLEDKVQHQQCSGRNSDALSRTISAVGSPGGTVAYLDFLVLVSKIESYRMQ
HRNGVYVAASMLKQIICLNTSTLSLVAMFAISMAVKRLDILNGMYLLFFIGLACVPWYMLYCWFIIVAYTALHVAVRFTV
MVYNASYHPNDTPSYWMEIIGIDIGKDPFALLVYFLLLILAVFQLRISRHEASGKITIQEILQRMEWCRYTSCDFFPQFY
RHFLELSTSLVLVMMALFIPHNVFIAGFALLFLLYFSLGAYSKLAESVTLIALGAYNVAVLLISALYHVPAISNSFAERL
SNITVCQKITVERCALDVGVSQNNQFGSMSLNLLPWYLAAALSVALCRHYFGVLGRGINRREEGNDDEGASVRMEEMQNM
PDPSISNRRGAREEEEEEVARERNHAMRGERDFLENDGRQRMGLFFCSYTATRGTFIGRCVPMAFAISRYLYLVVTFIRE
AGTAQGKLMVWVSLAYASLSNFSVLGAAFMTLFLLDSRGMPVVAVAVAQMALNYVYPFFFIPEAPLSVSSKRFFGLQKTQ
NGERPSILPPILACAMAVFYMHTEKDRTARHQEDALRQAHRRNNPPYHNPSARDGMRAFVRSEEIQTPYVPFVASRENRE
RTREVYEPPAKFVTLKQHLIFMWNYFRTRFFLDLNFELTVLVASLGLALTPDRVTGLVFFVELLLMWLIGRVRSTIEIRY
AVLQESLIVIVLGGLYFIRLGLPKGLVGVSILHPEECNAWDHYCGCGLPLHHFVLMFALVVMRRCMRQNVAKVRATILCV
EGAFELGELLRRKEKEVEDCRRLLRSDIESVLPAPSRDIIRNPRTLFDLLIAVSCACLPAAVFAFVQGVLMASLLGVVEI
AASLWILAFKRYLAWRWHKVWPFFILFLFLTFVPQLVARLPLSPPLTTHAENLMLALGFSPWTRGTTVGQAMVLFSAVVQ
QRIFSEFFFAAYLIGLCRGSLAAVERNREMLEYFRRKDEELQCQVVKEEEALKRRLEQLFSERNMCACQDEIEIGALMPP
QRVNEKETREEREFSSGVAPHSPMMGSVSKVPLSVSAQSDTYFSVLDSPKQLTKAGAAVDCPAATFDGRLSGVCSEEHVP
PAREDDRKGGICSKISNAIECWSEQLVQYFTFRTYRGKAPPRTYSQGYRVLFAFTQFLLRKYAYVCYFLFMLNYALSGTI
VDMVLSLSAALYGMLILPWSGKIYWRNALIYNVFSILVKCVIQLIVKWFAMNQMALKIVSACVLDIGLDRTEPSFSAMNL
DIIMDFVLFVSIIIHRQFCFDYGVFAKEHEEPFIPHRMETEKGEVHRKEKHHRNEESTAGRRELPEEDMDRIDVQCVVGV
ANEGRPSRQEPLSASSSSSSSSTLELLANKHDDNNVTNSKHDGIGEYNNSMRQKWQKRVFKKGGVLQKYWSNICERYGTG
SDYYTLQFWADGLSLIVFTVVYFLLAGDFRGSILYSVQQDLLPWQLVLILFAGVILMAAERIVYVLHSVQLKFVLHVVTI
LAYHAIFMLWRLTLAHRSTTVAVIILLMRFFSGSVSALQLQKGYPLHRKHDPFTTHTDIFHWLGHVVYRAIPFLFELRLL
LDWSVSCTALKLQDWMLLEDVHHTVYMRYVDINDLAWTSPRKGRQFPFFVRMYQGIVGFAACLLVLFFPLMLYSTFNPNV
GVNLVASWQTKIAFGTTSNFYTATATEVSVSQNLVSILWDLLPSLQHDEFGSQGLLQLLMFPRCSAEVWSATPETRLLLL
SQLNAAVNNETTFFIHKEDHVVRMEVSAPATRRVCSYQRYMVPWSTVVRLRDALEGAHLWYTSRHLEKHQGGVHSASTLV
YESGDWIPLPQFYSPFVNNIQNDLVMKNYVRTDCAVQLNGVGNSDGKTPPVLYWCVRCNSFANLTDGSTTRTWSMNGANE
PLDMADSDNDNVEVMQSKETLESGTDAGNITSIFEIVASSYVALNPSLVFLPNMGIIALYTTFILAIGTFLRNTVMDRAH
RVVLMQVANPDPIAELLRYIYMARSSAINGYVDGLLLEQQLFFELVDMLRSPERVLALSGRRVDDYDNCGRFCKYLKKSS
YHPF