TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4FMH8|Q4FMH8_PELUB Putative uncharacterized protein OS=Pelagibacter ubique GN=SAR11_0793 PE=4 SV=1
MKFIKIFLTSLCLIITTVANADVASQALNKVSEKISNLIPGEGITEVSLDYNDGDEDQLNFSILGVRDIETTDNSNFFTQ
FSLMNQEINSSGRIIGNIGLGYRKLSEDKNFMFGANTFYDRDLTEGQDRLGLGIEAKGSILDLTANSYTKISNSEVVNGD
REQVLSGWDFNLTSQIPRAPWARINYNGYKWETEKGSADQKGNIYSLELDVTNSVEVVASLDKSSLNGVDDETSLSINYI
YPPKEKSMVMSDGLSNDMFEKSNMEQKLKEKVRRRNKLVMEIQGAVVMTKK