TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4Q4W3|Q4Q4W3_LEIMA Putative ATP-binding cassette protein subfamily B,member 3 OS=Leishmania major GN=ABCB3 PE=3 SV=1
MGERVAAAGQEAQRSPHRPLPPVDQPASPGDALPFDAAQKTSTGDATAEPETSVKKEKPTTSITTPPRLDGIQISEKASD
IPVGRVLWKMWTYLWPHGEPKIKMLVASSVVCVLVAKVLRVAVPFWFKTIVDLLAPTTATAEAVAVAGPLTVGVFGCVVA
YGICRITTFVSEELKTVLFAPVGGHASTKLSMEMFNKLHQLDLDYHLSRETGVLSKDLDRGSRAFWSLAYVLLFMIAPTI
FEMGLVCYALNSQAGPQFIGIALIAVFSYVAWTFSVTNWRSKFRTRYNALESRVGGLIVDSLLNYETIKYFGSEKYESER
IREETENMNKKLVILDQTMALLNFGQQLIFVVASVLSLYLATCGVLTGAMTVGDLVLVDALLMQLYMPLSYLGMIYREVQ
SSTQNMQAMIALLDQRSNMKDTADEKAYKYIDGTIELRNVTFEYKTELDRLVLRNLSLTIPGGKTVAFVGPSGSGKSTIF
RLLFRFYDPTSGQVLLDGQPLDKLRMESVRKCIGVIPQDTVLFNESVRYNIRYGRMDATDAEVEAAARAASLHDTIARMS
EGYDTSVGERGLRLSGGEKQRISIARVLLRDPPILLADEATSALDSMTELNVMETLKNATERTRRRTIVLVAHRLTTVKE
ADMIFVLDGKGGLAEQGTHAELLGKDGLYAAMWHQQLSEQYQATGGAAPEDAQATDAEPAATHG