TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4UJ86|Q4UJ86_PARTE V-type proton ATPase subunit F OS=Paramecium tetraurelia GN=vhaF1 PE=3 SV=1
MSKKTFKKSEGTSLVSIIGDEDTVTGFLLTGIGEKNIKGETNFLVVDSKTDPKLIEATFQNFLKHPNIAVILVTQFVAEN
YLRHIINQYDAILPTILEIPSKEYPYEAKKDTIIQRAHRLLYGTDIQ