TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q4WHY8|Q4WHY8_ASPFU Ctr copper transporter family protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G03730 PE=4 SV=1
MDHMSHNMDSMASMTSTMTMAMSASSTASAPMSTGSAHSMGGMDMGGKDSMHSCKISMLWNWYTIDSCFLSSQWHNTSRG
MFAGSCIGVICLVICLEFLRRVGREYDAFIVRRARLRNQYLSTTASSQGLTRATDADASAEDSPNSTRGVVRAASKGAGR
TLCSAFEDKTPVRPTLIEQLVRALLHMLQFAVAYFVMLLAMYFNGYIIICIFIGAFLGSFIFSWEPLNLQKEYVIPLPLP
YLPQMICKELGLTCVLV