TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q50614|Y1819_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1819c/MT1867 OS=Mycobacterium tuberculosis GN=Rv1819c PE=3 SV=1
MGPKLFKPSIDWSRAFPDSVYWVGKAWTISAICVLAILVLLRYLTPWGRQFWRITRAYFVGPNSVRVWLMLGVLLLSVVL
AVRLNVLFSYQGNDMYTALQKAFEGIASGDGTVKRSGVRGFWMSIGVFSVMAVLHVTRVMADIYLTQRFIIAWRVWLTHH
LTQDWLDGRAYYRDLFIDETIDNPDQRIQQDVDIFTAGAGGTPNAPSNGTASTLLFGAVQSIISVISFTAILWNLSGTLN
IFGVSIPRAMFWTVLVYVFVATVISFIIGRPLIWLSFRNEKLNAAFRYALVRLRDAAEAVGFYRGERVEGTQLQRRFTPV
IDNYRRYVRRSIAFNGWNLSVSQTIVPLPWVIQAPRLFAGQIDFGDVGQTATSFGNIHDSLSFFRNNYDAFASFRAAIIR
LHGLVDANEKGRALPAVLTRPSDDESVELNDIEVRTPAGDRLIDPLDVRLDRGGSLVITGRSGAGKTTLLRSLAELWPYA
SGTLHRPGGENETMFLSQLPYVPLGTLRDVVCYPNSAAAIPDATLRDTLTKVALAPLCDRLDEERDWAKVLSPGEQQRVA
FARILLTKPKAVFLDESTSALDTGLEFALYQLLRSELPDCIVISVSHRPALERLHENQLELLGGGQWRLAPVEAAPAEV