TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q50863|RFBB_MYXXA O-antigen export system ATP-binding protein RfbB OS=Myxococcus xanthus GN=rfbB PE=3 SV=1
MPESMDAIILKDVVKSFRKRTIRGEYTTFKSELLRWLRGKRQSRDASLITALRGINLTIPKGKTVGIIGRNGSGKSTLLK
LITGIYTPTSGDLQINGRISALLDLGAGFHPDFSGRENILINGIILGMTRAEVRARMDEIIAFSELGEFIDEPVRTYSSG
MYMRLAFAVATHVDPDILIIDEILAVGDEHFSKKSLAKMMDFKRQGKTIVLVTHELGTVERWCDLAAWIDGGYVRRVGKP
SEVTAEYREAISLAEAQSAAFTPPALTEGGGALPQVPSESLPAEGPVRIHRVQLLDARGESLEVLSPEEGLEVRADFSVE
GPCEDVDFHVRLQAADGRTLYETSTRSEAVVLSRMPNPGVLRFVVERLGALGGDYSLVVSARASKGESSGRCAFRVVSAT
EEEGVFRPPHRWLVEPGANSQAGVRFEPGTSPRVEVG