TCDB is operated by the Saier Lab Bioinformatics Group
>Q51662|NORC_PARDE Nitric-oxide reductase subunit C - Paracoccus denitrificans.
MSEIMTKNMARNVFYGGSIFFILIFGALTVHSHIYARTKAVDESQLTPSVVEGKHIWERNACIDCHTLLGEGAYFAPELG
NVMKRWGVQDDPDSAFETLKGWMESMPTGIEGRRQMPRFDLTDEEFRALSDFLLWTGTINTQNWPPNDAG