TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q51664|NORQ_PARDP Protein NorQ OS=Paracoccus denitrificans (strain Pd 1222) GN=norQ PE=3 SV=2
MNAHVKTQGNGAVDAPFYLPQGDEVAVFEAAAANDLPVLLKGPTGCGKTRFVAHMAARLGRPLYTVACHDDLSAADLIGR
YLLKGGETVWTDGPLTRAVREGAICYLDEVVEARKDVTVVLHPLTDDRRILPIDRTGEEIEAAPGFMLVASYNPGYQNIL
KTLKPSTRQRFVAMEFDFPEPAREVEIVARESGLDRDRTLGLVRLAGKIRGLKGQDLEEGVSTRLVVYAASLTRRGMNLD
RAIEAAMIEPLTDDAEVKRGLRDLAAAIFG