TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q51665|Q51665_PARDE NorD protein OS=Paracoccus denitrificans GN=norD PE=4 SV=1
MGLDLEPWEPEETVGKIWHVWASSFGAPQAFEDQAVALSEVSGRLAVLFRALGGGAAVEIRPAAVQASHHRIGWLRRLGT
PAETVPHASFDGEILRLPERLSVLPSRQANGALFLWLAACAAHGSLAPAQGDPLFRDLVRLGAAQRAVEATLQDAPGLTG
LYDDLAELVLSLRPVAPLPPAEAVVEALARHLLGDPAPLPPLARDWLAMLDDPQVKAPRDYRPMRPVPLWPDLALPETTL
AAAPGDAPDGIAADPANARMFRARRRQSDQPQRRDSLILHKFEALLSWADLMNLNRHVDDDDQDDAKKAAEDQEELGLGQ
VSKAPATRLRLHLDLAPEDADLEAVAGIRTYPEWDARRGRYLAHHVRVLENRAPEHDEALTPDPRAQTRIRAVPRQFEAL
RPGRLITTGHRDGDELDAELTVRAAADLRATGQGSDRIWRQSRPLARNLAVSILLDVSRSTESAVTGRAVIEIEREALAA
LAWGLDACGDRFAINAFSSLKRDRVFLSACKDFDEPMGAAIERRIAGLRPRFYTRLGAGIRHASAGLSAQASSRRLLLVI
TDGKPNDLDHYEGRHGIEDSAMAVREARRAGHAVHGITVDRDAKSWFPRIFGQGGFSLIPHPDRLLAALPVIYRQLVA