TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q51666|Q51666_PARDE NorE protein OS=Paracoccus denitrificans GN=norE PE=3 SV=1
MWVLIASELLVFAAGITAMAGVRLTDPAGFAAAQAQLHGWMAALNTAILVTSGFFAARAERACRRGDRRGARVGLALAAL
GGAGFLAVKAVEYAGDLRAGLGMESHPFFTFYYLLTGFHAAHVLFGIGVLALVAIRLRTEEVQAGAAFWHMVDLVWVLLL
PPVYLLG