TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q51667|Q51667_PARDE NorF protein OS=Paracoccus denitrificans GN=norF PE=4 SV=1
MDLTRIWLILLGLTGATTALAFVPGPVAAAALLAVALFKARAILGGFLHLERGSGWWAAFVVPLTIWLVLIWGLHVI