TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q52PA5|VEMP_FIPV Envelope small membrane protein OS=Feline coronavirus (strain FIPV WSU-79/1146) GN=E PE=3 SV=1
MTFPRAFTIIDDHGMVVSVFFWLLLIIILILFSIALLNVIKLCMVCCNLGKTIIVLPARHAYDAYKTFMQTKAYNPDEAF
LV