TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q53787 ORGANIC ACID TRANSPORT PROTEIN - Streptococcus bovis.
MEKKLPATAANETDWRNKLTKTRIGSVTLPVYLVTASIILVTALLEQLPVNMLGGFAVILTMGWLLGTIGGNIPILKHFG
GPAILSLLVPSIMVFFNLLNQNVLDSTDILMKQANFLYFYIACLVCGSILGMNRKILVQGLMRMIVPMALGMILAMGVGT
LVGTLLGLGWKHSLFYIVTPVLAGGIGEGILPLSLGYSAITGLPSEQLVGQLIPATIIGNFFAIMCSGLLSRLGEKRPEL
SGQGQLIKITNSDDLSDALEEDKAPIDVKLMGAGVLIACTLFITGGLLQHLTGFPGPVLMIVVAAFLKYLNVVPKETQRG
SKQLYKFISGNFTFPLMVGLGMLYIPLKDVVGMLSWQYFVVVISVVFTVIATGFFVSRFMNMNPVEAAIVSACQSGMGGT
GDVAILSTANRMTLMPFAQVATRLGGAITVITMTAIFRMLF