TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q53902|MMLA_STRCO Putative membrane protein ACTII-3 - Streptomyces coelicolor.
MTRTLLSWPGGRRLKWLVLAAWIGLLIVLQPLAGKLGDVESNDAAAWLPGNAESTEVLELSEKFQPADTSPTVIVYDRPS
GITAADEAKARADATHFADGTGVVGEPYGPVRSDDGKALRTVVNVHLGKDGWEGLNAAAKDMRAIARPSAPDGLGVHVTG
PTGYAADSAESFSSADFKLTLVTLLIVVTILVVTYRSPLLWLLPMISAGMSLVISQAIVYLLAKNAGLTVNAQTAMILTV
LVLGAATDYALLLVARYREELRRHEDRHEAMAVALRRAGPAIVASAATVAVSMLVLLLAALNSTKGLGPVCAVGVLVGLL
SMMTLLPALLVIFGRWVFWPARPKHGTEPDVTRGLWSRIARLVSGRPRAVWVTTSLLLGAVATLAVTLNADGLQQKDGFK
TKPESVVGEEILTRHFPAGSGEPMVVIAKGASADQVHAALETVPGVIEVAPPQVKDGLAYVEATLGAGADSPAAMRSVTA
ARETLARLDGAQARVGGSSAVVHDMREASSRDRGLIIPVILAVVFCILALLLRALVAPLLLIASVVLSFFTALGLAALFF
NHVFDFAGADSAFPLWVFVFLVALGVDYNIFLVTRIKEESDRLGTRQGALKGLTSTGGVITAAGLVLAGTFAALATLPLV
FIAELGFTVAVGVLLDTMIVRSVLVTALTLDVGRWMWWPHPLARREDPSEDPAVSGMPDSIDSEASTTASR