TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q54KF7|SIBA_DICDI Integrin beta-like protein A OS=Dictyostelium discoideum GN=sibA PE=1 SV=2
MNRILTLFILFISLFIVCEATHFRFGTMSWMPMGSHNTIKFSSNYAFRIGFFKKFNKGCNVGDVVKVGDLDLGDDKTKVD
VNLVVTSVNQADDWFTGEFSYTHTYNPIKLGGKAVTYKVVFTDCCRIKSLLNNAEGSWYISTSVVVDPNQGSDVSTFNRS
PVSGMVPIITLNRDKNNQFLIAASDPNGDTLTYSLSNAYTMNQPSGLSIDSSKGIVSFKPTVSGFYSTQIMIKDTKGAYV
VVDFLINSVIEPGVCHPSCSNGGNTCNGNSGCKSCKGTDSNGNTCSSFPPVFVYPPTPTDGSLLAYEVNKTNSFSIQCKT
EEKSKTVFIQPANIPLAATLTSSDQNKQVSTLTYSMLPQLKHIGVYVISAYCTDNKGLVSTITSFSISVEKPICGHGTNK
PGGGCNCETGWDPEKNCYECLKGHYGEKCDPVDPCVNGESNEGSQGNGKCTCYYGWEGKNCDIKVNQVCNANKENVVLDS
SVAKSSYINPNFAQVYLNTDPSKQALTLSSKLSIPETIDKFEVLVLVDSQPSIVEYWDNFKKYSSDLTKNLQDISETVSI
GLGLFSDAKTNGYSFVLKKSIGNGLSGLDDKDKAPASSYSTKNSLIALTSAAEFPAGWSTGSIKIIVLLTDNDYSATAQE
VSKFTSTLISKSILPVVVSFNDNQNWDTLFKNQGFGSTKKTSNAKGNDWVSVATSAIKDVLSKAVVKAIDDTKGFLTLPS
ATTISIEDSKDYTIPIQIKYPQGQSDIPQNPSVSYSVVGFGITRIVINYNSAPTALGYSIETKQNVNYNFKLSGSDVDGN
TLTIKFKTIPAASVGVIQADGVTIEQGDSFSIEKTFTFKPATNYYTKSTNDKFTFVANDGCLDSNEATVEIKITHVNQAP
SCSSLSGSAISVTGLNTPKSFSLQGSDIETDSNLKIVFGDLTAISAYGNIKSGSNVVSTGSSVQLSSGSASLTFTQTKDI
ANDKEITVDFKVNDGSLDSSSSCSFKVKFVHFNKPPVAFAVTPLTIRQNSELKITISASDSDSDSVIFTLDDLKLGGGDS
FFKCDDRSQLTAPFTTQPVSISGGVASFSEICYSSPLVNANSYASLVFFANDGQLSSDKFKVLININGDRPNAPPVVNQI
PNFTMNEDDISNELVIDGIDPDELDQGKLKGIIIQKPTNGVILVKSGSSTSEAPIIGNAPYKIFYKPNPLYYGTDSFSYT
VEDSMGERDATPKTTQITVQHVNHAPTLSIDPYDFTSQTSEKTLELTPKDIDLIDTVFHCTIVKLPATAIIKTSAGKVID
TVPTDLSDNKYIITSNNNIYNDFSDSFDAKCYDSSNAVSNIATGPITFRYINVPPKAESSDETLNQDSSVSFSVKATDLE
DNSNVRAVIRSLPAKGTLTIKSTGKAAEISSTYAIDDFVYTPVAGYSNWDKPGHVGPADSFNFVAKDSKNDISSNIGTVS
FFIEPRNPPTYEGLAVLYTKENTDLPFSISGIVGNGGSNVFLRIKSIVSRGSLYATHCMGTEGCMSEPNPVDININFTSQ
PYTFSFTPIEYENGDNYAIIEFVLYDKFNGQEVESQKYTIIINVIPVNQAPEVILIEHTLSTLPNNVIAFDKFKTVKMET
NSYVIIKYDGTDIDDPKEKLKSYIVSPPLRGLLYVYDKDAKDGLGKLIKKDDTFVPVAQDGFWYIVFVPTPGSSGDGYVR
IPISMVDFLGDISVPVTVAVDVSKKNIPPFITIENKNYTSLANTSIVVTGVSFDDPDSKYNDVELILSLVNKDGDLVSNK
IATFSLSQQSKAKCTKHSEFAQFTCRSNKKTLNALISTMYVNHQGGGSYRLKVFVNDLGYSSPASIRDKNHMTATDYVEL
DVTKPEVTTTKENNNKTVLTGAIAGAAAGAGLLAAGAWFLLKKSAPPTDAFFGEGAFADGAVSTNPMYEESGRSAINPLY
EASSENL