TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q55026|SRPB_SYNP7 SRPB PROTEIN - Synechococcus sp. (strain PCC 7942) (Anacystis nidulans R2).
MNVIFLPQGDWLGLSFRLLLAMLVGAVIGLNRQRGGRPAGMRTFTLVAMGSALFVMVPIQAEGDSSFAAINALSRTVQGV
AAGVGFLGAGLILQRAPKTKRSGRPRVSGLTTAATIWITAALGAVIGCGLWQLGLIGTFFTLLTLSGFKRLQRIAWLRQS
WERLIAWEAKTLPPDAEEEDDD