TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q57399|Y1470_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1470 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1470 PE=1 SV=1
MNKALSVENLGFYYQAENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVYQSIGFVPQFFSSPFA
YSVLDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALD
LANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAIANKTLLLNKQNFKFGETRNILTSENLTALFHLPMFEQQAQYKESF
FTHFVPLYKTLLK