TCDB is operated by the Saier Lab Bioinformatics Group
>sp|Q58086|Y672_METJA Hypothetical protein MJ0672 - Methanococcus jannaschii.
MRLSKEFIGLGIITASLIFGSSLPDIYKGIVILIVAGCLWFFELLPLPVTSLAIPIMAVFLGIFNLKEALTYFAHPIIFL
FLGGFMLAQALKNHNLDKFIAYKLLNYGKDFKTTCFLMFLSAYFLSMWISNTSATLILLPIALGLLHKKTGKLRDFLLLG
VAYSASIGGIATIIGSPPNAIASSYLDYGFFSWFKVGFPISLLLFLICTLTLYIYFKKWIPKEDIAIQARMELSRNAYKL
LVIFVLIASLWIISDYLSEIFNVQYFDSVIAIFAIILLFVFNLVEVNDFKKIDWGTLILFGGALCLGGVIVKSGANTFLS
EKLIAILGNLTPIVLLFLVVTITIILTNFISNTGLTGIIVPILFGVSLGIPKEILILAVGMSASCSFILPVGTPPNAIVY
SEGVKKEEMMKIGMILSILSAAVITLYSILYL