TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q583G7|Q583G7_TRYB2 Amino acid transporter 10, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb927.4.4820 PE=4 SV=1
MHVSAQARQTLCYHCCWMASAVVPTTDREQINKADVTSPFGSCEVISGEDEGLKGKNALPANEGEGEQSSMKCFTSMIPP
GGLVSTAFSLASICIGAGILGLPAAANSTGLVMTFVYPIIIYFLCVYSLYCLGAQMERHRFRSYEGMARALLGQPCLYFT
GVLRVVNAFGAAVAQIIATGDIVSTILKGTDAPNFLKEKWGNRLLTFIMWLCFMLPLTIPREVNSLRYVSTISVFFVFYL
MVVIVVHSCMNGLPENIKNVHVTGAPGDEGIHLFGTSNRAVEGPGVFTFAFLCHISVFEIYFGMAKPSAHRFTAYSAIAM
GICLVLCVMTAFFGYLDFGRDVAGSVLLMYDPVKEPAILVGFVGLLVKLFASYALLAMTCRNGLCGIIGLDTEKLSFFKH
CTIIGTISIIMLLCGLFIPNINTVFGFVGSVCGGFLGFILPSLFMMYGGNWSLSTVGWLHYIATYAVLFAGVALSVFGTG
ATIYGVAVGW