TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5D8X4|Q5D8X4_SCHJA SJCHGC00839 protein OS=Schistosoma japonicum PE=2 SV=1
MDGYNPVESPSGSPKSFIYLVIASQIFGLLAVVLTAVWLGKFWGGFSWTNANTVFNYHPLFSVLGLVFLYGDSILVFRVF
RSYRKLPVKILHAVLHILAFLFGVLGIKAAFDMHNALSIPNLYSLHSWLGITAIVVFGLQWVGGLIGFLVPQTPQIARSK
LLPIHVTFGSFLYLLMIGVCISGITEKNFFSKNYSVLNARELIGNLIGVVLVIFGGLIFYLTHHPNYRRIEPVPPECRAL
QK