TCDB is operated by the Saier Lab Bioinformatics Group
>Q5I0E9|S47A1_RAT Multidrug and toxin extrusion protein 1 - Rattus norvegicus (Rat).
MEVLEEPAPGPGGADAAERRGLRRLLLSGFQEELRALLVLAGPAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAVI
NVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMVF
IPALPAAFLYTLQVKYLLNQGIVLPQVITGIAANLVNALANYLFLHQLHLGVMGSALANTISQFALAIFLFLYILWRKLH
HATWGGWSWECLQDWASFLQLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSITYELAIIVYMIPAGFSVAANVRVG
NALGAGNIDQAKKSSAISLIVTELFAVTFCVLLLGCKDLVGYIFTTDWDIVALVAQVVPIYAVSHLFEALACTCGGVLRG
TGNQKVGAIVNAIGYYVIGLPIGISLMFVAKLGVIGLWSGIIICSVCQTSCFLVFIARLNWKLACQQAQVHANLKVNVAL
NSAVSQEPAHPVGPESHGEIMMTDLEKKDEIQLDQQMNQQQALPVHPKDSNKLSGKQLALRRGLLFLGVVLVLVGGILVR
VYIRTE