TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5J2D5|Q5J2D5_CAEEL GABA transporter protein - Caenorhabditis elegans.
MVEATSVAEREQWSSWADFIMSCIGYAIGLGNVWRFPYLCYQNGGGAFLIPYCISLVFCGAPLFILETSWGQLMSVGGLG
MFKICPIFKGVGIAAAVMAFWLNIYYIVVLSWAATYLYNSFTMSDVPWKNCDHAWNTPNCRSEYVKIPCDSNRTIAEFFN
VKVLTHDHIHEYKKQFFVGEKMNWTVCSAADLSVVSPVKEFWNHRVLGISSGLENPGGIRWDLALFLLLVWIICYLCIFK
GVKWTGKVVYITASFPYMMLFCLLIRGLTLEGAGVGLEFYLKPDFSKLLESKVWVDAVTQVFFSYGLGLGALVALGSYNK
FNNNVYKQALTVCFVNSGTSVFAGFVIFSFIGFMATQQEKSVAEVAQAGPGLLFLAYPSGILQLPYTQFWSCLFFLMVLF
LGVDSQFCTMEGFFTAIIDEFPQIRRKKYGREIFVGVICVISYLIGLTTVTEGGFYVFQLFDFYAASGWALLWLLFFECI
AISWSLGIDRWYEHMKSMIGYYPSAWWKFCWVFATPSVCFGVLLFGLIKYQPLRIDAYNYDYPVWGHIFGWFLSLSSMLC
IPGYAIWIWFKTPGTVQEKIKLLCRPDIEIKGAMENAENLELVEDFQNAI