TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5LCC7|Q5LCC7_BACFN Putative membrane protein OS=Bacteroides fragilis (strain ATCC 25285 / NCTC 9343) GN=BF2538 PE=4 SV=1
MELLRNLFEGYPNLWGGGVAHSVLILSLVIAFGIMLGKIKVAGISLGVTWILFVGIVFGHFNLNLNEHLLHFLKEFGLIL
FVYSIGLQVGPGFFSAFKKGGFTLNMLAMIVVFAGVIITLALHFITGIPITTMVGILSGAVTNTPGLGAAQQANSDLTGI
DAPEIALGYAVAYPLGVVGCIMSLLGLKYLFRINTKQEEAEAEQGLGHLQELTVRPVSLEVRNEALHGKRIKDIRPLVNR
NFVVSRIRHLNGKKESELVNSDTELHLGDEILVIATPIDIEAITAFFGKPIEVEWEQLNKELISRRILITKPELNGKTLA
QLKIRNNFGASVTRVNRSGVDLVASPQLQLQMGDRVTIVGSELAVSHAEKVLGNSMKRLNHPNLIPIFLGIALGCILGSI
PFMFPGIPQPVKLGLAGGPLIVSILISRFGPQYKLITYTTMSANLMIREIGISLFLACVGLGAGDGFVETIIHEGGYVWI
AYGMIITVVPLLLAGFIGRYAFKLNYYTLIGVLAGSTTNPPALAYSNDLTSCDAPAVGYATVYPLTMFLRVLTAQLLILS
LG