TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5MP79|Q5MP79_9ENTO Capsid protein (Fragment) OS=Human coxsackievirus B1 GN=VP1 PE=4 SV=1
QTRHVKNYHSRSESSIENFLCRSACVYYATYTNNTKKGYAEWVVNTRQVAQLRRKLELFTYLRFDLELTFVITSAQQPST
ATSVDAPVQTHQIMYVPPG