TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5MQC2|Q5MQC2_ECOLX Outer membrane protein OS=Escherichia coli GN=wzi PE=4 SV=1
MIKIARIAVTLGLLSSLGAQAYAAGLVVNDNDLRNDLAWLSDRGVIHLSLSTWPLSQEEIARALKKAKPSYSSEQVVLAR
INQRLSALKADFRVTGYTSTDQPGTPQGFGQTQPADNSLGLAFNNSGEWWDVHLQGNVEGGERISNGSRFNANGAYGAVK
LWNQWLSFGQVPQWWGPGYEGSLIRGDAMRPMTGFLMQRAEQAAPETWWLRWVGPWQYQISASQMNQYTVYPHTKIIGGR
FTFTPFQSLELGASRIMQWGGQGRPQSFSSFWDGFTGHDNTGTDNEPGNQLAGFDFKFKLEPTLGWPVSFYGQIIGEDEA
GYLPSSNMFLAGVEGHHSLGKNAVNWYVEAHDTRTNMSGTRYSYWHHIYTDGYYQQGYPLGDAMGGDGQLLAGKIELMTE
SNQRWSTRLVFAKVNPDNLVINGAFPHSDTLKGVQLGWGGDVYQSVRLNTSLWYTNANNSDSDDVGASAGIEIPFSL