TCDB is operated by the Saier Lab Bioinformatics Group
>Q5QM84|TPC1_ORYSJ Two pore calcium channel protein 1 - Oryza sativa subsp. japonica (Rice).
MRERGEMREAKAPLIAEAAEHISHSHGSGSSGTGSHTSGGGGGWRGSRQYQRRSDALAYGNRYQKAAALVDLAEDGVGIP
EDVLNDTRFERAMRFYFVYLRLDWLWSLNLFALILLNFLEKPLWCRGYSQHACDQRDLYFLGQLPYLSKTESLIYEGLTL
VILVMDIFYPLSYEGLNLFWKNTINKLKVLLLFILACDILVFAFSPQPFRVAPYIRVAFLIMNIRELRMCAVTLVGMVGT
YLNVLALSLLFLLFASWLAYVTFEDTPQGKTVFSSYGTTLYQMFILFTTSNNPDVWVPAYKSSRWSSLFFIVYVLLGVYF
LTNLILAVIYDSFKEQLAKQVSQADCTRKSILEKAFGIIDATGQGYLNKEQCLSLLDELNKYRSLPKTSREDFELIFAEL
DQSGDFKVTSEEFATLCNTIAIKFQKEPPPSYLEKYPSFYHSALCEWLKSFVRSPLFEYIVIFVLLMNLVAVIIETTLDI
ENSSSQKVWQEVEFVFGWIYVIEMALKIFSLGFGAYWMEGQNKFDFVLTWTIFIGETLTFAFPSKLSFLSNGEWIRYLLL
GRMLRLTRILLQVRRFRAFVATFFTLMSSLMPYLGIVFCTLCIYCSLGLQIFGGIVYAGNPTLEETDLFSNDYLLFNFND
YPSGMVTLFNLLVMGNWQAWMESYRQLTGSYWSLIYFVSFYLISVLLLLNLIVAFVLEAFFAEMELEKDGEADIQDPTLE
GRNRRRSVRVRTKGTMVDILLHHMLSNELDGSQNRDQ