TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q5Y4S2|Q5Y4S2_RHIFR Nodulation protein OS=Rhizobium fredii GN=nopX PE=4 SV=1
MSASNLLPMISSNPAQFAQASLAKAFAPRVAQGQQSVLSFEAMLSTNMLDRIGPLASREDLLPPDAESTLEDLQKDPLAL
LPPHMRAAIESMDQTPQSAVAIDDHYVAPAPIQSSRITWNGGSLTKPELQIVAVLNRHKDLCPLSWESLEAKVNDPSTPP
DLKAAIEALLQDPELFYAIGSQGDGRCGGKITAKDLSEFSKHHPQVAAFQESQAQSYAQNYIPSDSAENAQPSVMTENDA
LRELYRYSEYLPKNLSLADFKQIVDGEAKTGKCPPQVIAAAQYFVSHSEEWKRLYGGNIDKGHKEDFLQVASSSMSLTQA
ELDTLKTINSHQELFFGSGDLTRDKLASMADDKSLDPKVREAASQLLSDPLLFGLLNNAITGYKTHHGFFDFGGGHTVDS
GNVSKEDFGRFYTNMTTANRTVQQPKFHVPETEAAQNAVADMKMGLADQPDIKSPKKNGGALMHVVDSVLRVGSKVLDWA
ATAVGVLSFIPGIGQVADLVSMTLACEAQAANLLRTAITGGNMKQALIEAGIGVAAQAVGLVSGPGVKLAIRNGLARKAI
EEAATAGINLPLSMAQHYAEGYLNDLKARLTADHPA