TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q609S8|Q609S8_METCA Putative membrane protein OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=MCA1150 PE=4 SV=1
MSAHPLKISWCFSARSMLVYKPSLAIGKSANTLSNKRAALLFLLFMFYGPAIQVVGEFRYVEIVVLVLLVFNFSRAVRYL
GNLEKLLISLFLLAAMAHVVADLVTNASIEGTIKRTGTYIILAMLIIGLHWLAHGDVARIRWMLAGYCLSYLIVYLAGIE
TPSRGYLIGPWRLGLGMATTIGVALMIAWQPRLQRIGGLALLAMAGIHWMSEGRSVAAITAVTGMLALSSSLRSSYYPAP
FNPWIVIGFIVFSSVGIICLNYGLEIATENKMFPSEMQKKMETQFASRYGLLGGGRPDAFVALYAISKRPFLGHGSTNLD
PDVWYFYSELNAEMYAQMNDYERILLHELNKEWVLGTPSHSHLLGAWADAGIIAALCWFAVLGLCIYVFVRVMFWRHCLA
PLIVLIAVSTIWDILFSPGPARMDMAFRILILTHAVKLLRTFDLCMTRNLVVQRRHQISQTSDLGCFAKGP