TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q63GK8|Q63GK8_BACCZ Protein-N(Pi)-phosphohistidine-sugar phosphotransferase (Enzyme II of the phosphotransferase system) (PTS system glucose-specific IIBC component) OS=Bacillus cereus (strain ZK / E33L) GN=ptsG PE=4 SV=1
MKITSFDFWQKFGKALLVVVAVMPAAGLMISIGKLIGMSAGDINAVHTIARVMEDIGWAIITNLHILFAVAIGGSWAKDR
AGGAFAALLAFVLTNRITGAIFGVNAEMLADSKAKVSSVLAGDLIVKDYFTSVLGAPALNMGVFVGIITGFLGATLYNKY
YNYNKLPQALAFFNGKRFVPFVVIVWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPIVAPFVYGTLERLLLPFGLH
HMLTIPMNYTELGGTYTMLTGSKVGQVVAGQDPLWLAWITDLNNLLANGDTKAYNDLLNNVVPARFKAGQVIGSTAALMG
IAFAMFRNVDKEKRAKYKPMFLSAALAVFLTGVTEPIEFMFMFIAPVLYVVYAITTGLAFALADLINLRVHAFGFIELIT
RTPMMVNAGLTRDLINFVIVSLVFFGLNFTLFNFLIKKFNLPTPGRAGNYIDNEDEASEGTGNVQDGSLATKVIDLLGGK
ENIADVDACMTRLRVTVKDLDVVAPEAQWKQNGALGLIVKDKGVQAVYGPKADVLKSDIQDMLGA