TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q64QZ2|Q64QZ2_BACFR Uncharacterized protein OS=Bacteroides fragilis (strain YCH46) GN=BF3345 PE=4 SV=1
MKIKRLLVLAVLPMLCLAVNAQNSSKDNTPKKGDFTVAATVGYNSYTSVTAPSGLLTDYEVRALSTNWADKKLMVGFEGG
WFFKDQWKLNLGGGVSFTNNPGYPAVPGTIDDSNKNNSADENMGEIPNYRAVADAQSFAYNVSAGVDRYFNIKRVPNLMW
YTGIRVGFAYGENEMKYDEETSMGKSIAESWNLRGALTIGVDYFVLPALYIGAQIDPFAYTYNKTTYNPQAGLGDLSADS
HNYSVLAAPTFKIGFKF