TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q64VU4|Q64VU4_BACFR Putative uncharacterized protein OS=Bacteroides fragilis (strain YCH46) GN=BF1634 PE=4 SV=1
MKKLGLLLMLFTFAACTNDDFSVLQENEEITLPTAVTRASGDKLYDLLGYGYDVTGLYFTSASAKSKIIDIVALRKDYEE
RVDIGAVPSNYARMTSGTTAQDYTRNVTSKVKLGGALSLFSGSLSSSFSSTQHYTSKYSIADYTSFIRRRRLFLTASTEL
LSKYLTKMFVDDLSKQSPSFIIQHYGTHVLTDITLGGRITVLYRSSINTSKKTATVEAGCASGIKNMFNLSVDGHYDQTL
VKDNSEQEIVYRTEGGDPSRALIGQLNYDSKNPSVIDISSWQQSCDDNNMTLVDAEPGSLIPIYDLVSDMGKKEQLKLAV
ENYLKEHSYVDIDDSSKGGAVRNNSRGHNTSSYGNSTRVIGANGNRSTYRRP