TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q65DD3|Q65DD3_BACLD Lantibiotic immunity protein OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580) GN=lanE PE=4 SV=1
MKNLLKAEWIKLRNSDFTMTSIFILTASLVFTGFMAKRITPFAGGNEWTSLRHLTLLLVFSTIYPWLVSSVTVFLHKDEL
KNRVWLNRILSPQPFAAMLFAKVLFIGLFAAALYAVCVIESLAFGLISGFPGPAPWFSWMKGFILNLLSTFPLICTVLWL
KFTSKEKTSLNIIVFICSLLSFGVSQSPLGLLFPWSFPVTALIAMEKSVAVLIGSIVWFTAVSQLFFSLLLKQIRPYQKG
GIQNESSRI