TCDB is operated by the Saier Lab Bioinformatics Group
>Q65ZW3|Q65ZW3_BORGA Virulence factor mviN protein - Borrelia garinii.
MNKYVISTVLVMISTFFSRIMGFIKVKIFSYYFGANLDADIFNYVFNIPNNLRKILSEGAMTSAFLPEFTCEKNKSHEKA
VSFFRTVITFNVIAIGLIVLVMIIFAKPIMYFLSYYRGENLIFASSVFSYLVLYILLISLSSIFISVLNSYKIFFIPSFS
PIMFSFGIILSIFLFYGRFGIYSAVIGVIFGGFLQFLIPFVNCLMIGFVFKPTFYFREKVFLNFLSRWVRMIFGFSISII
TQQISFALASTLDIGSVSILSNAIVYYQLPIGIFYISIATVIFPKMAEYAVLGNNIKLNTLLVDGIKILLLIFIPVSFLM
FIWSDYILNLLLMGGKFSIYDTQKTAGVLKCFLLGLLFYSMFSFFQKYYFSIRDAKTPFYLSVLFSILDILLSVFGIKHY
GLNALALAQSISFMICVIVFYFIILKSGVKIDLIEILFVLLKSIITLFPLYLIYFFFEKFQWNVGFSFKNLYFLITAGIV
SILTLFICYSVLGINKLFRFIRRDVL