TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q66AT6|Q66AT6_YERPS ABC high-affinity zinc uptake transporter, periplasmic binding protein OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=znuA PE=4 SV=1
MLHKNKWLKQAMLASALLLANPFNLASAAVVTSIRPLGFIAAAIADGVLPTEVLLPDGASPHDYALRPSDVQRLRSAELV
IWVGPEMEAFLSKPLTQVAENKQIALSQLPSVTPLLMKSDEHDEAEEGESGHHHDHAKDNPTDDHHHGEYNMHIWLSPAI
AKQAAIAIHDRLLELTPQNKDKLDANLRRFEDQLAQNEKNIVTMLKPVQGKGYFVFHDAYGYFENHFGLSPLGHFTVNPE
IQPGAQRLHQIRTQLVEHKAVCVFAEPQFRPAVINAVAKGTNVRSGTLDPLGSGIVLDKDSYVNFLSQLSNQYVSCLK