TCDB is operated by the Saier Lab Bioinformatics Group
>tr|Q6DDI9|Q6DDI9_XENLA Stx1b2-prov protein OS=Xenopus laevis GN=stx2 PE=2 SV=1
MKDRLTELSAVKGNDEDGETVVVVQKEQFMDDFFLQVEEIRNCIAKIADNVEEMKKNHSKILSAPNPEDKTKEDLEKLNQ
EIKNIANKVRTKLKSIAQTIHQDESANRTSVNLRIRKSQHTVLSRKFGEVMTEYNETQVQFRERSKGRIQRQLEITGKTT
TDDELEEMLESGNPSIFTSDIISDSQITKQALNEIESRHKDIIKLESSIRELHDMFVDIATLVESQGEMINSIEKNVENA
AEYIEHAKEETKKAVKYQSKSRRKKWIAAFLVLVLIGLIALIVGLSVGLK