TCDB is operated by the Saier Lab Bioinformatics Group
>Q6G2D1|Q6G2D1_BARHE Putative uncharacterized protein - Bartonella henselae (Rochalimaea henselae).
MSKKILLSYTTTAAIILFNIHSNAYAISLFSGEGENKTAPTQESYENIYALDGGKIHGKDLKIIGPSTQEESIITDISGV
EARKFGSMIELEGDTTIKNVSIGLLAKESGTIKMNDGSIQVKKVHIQTPIGIAAVSNGAIILNNVEIDASNQEQSIKTID
ETGIGDGTGASLKSGGTLSMTGGSIKSNYLGITLEESSSDKNKLENVKINITNLANATKESIGIRVIKTSKVTLNQVTIR
HARTSIHASDSSEITISGGLIQGNHTGINVEKESVITLKNDVEVLSNDHGLSANGLHSKITMQGGKLITAGLQPAVLAGS
GGEINLINVVVHIDDLTDIVMHIDDNETQTQKLELERKEAPLTTQGLQAQYAQSKITMIRGSITTTGLNPAVLAGSGGQI
DLTNVPMKVHNVGLQAQAEQSKIVMTRGSITTTGMNPAVLAGSGGEIDLNDVVIKTKDIALQAQDKQSKITMRGGKLIKT
GPRAAIFVTCGGQIDLLDAQLHTDSNGLAVRGRESKITLKDSEVRANILLVGKPNDEDDNGEANVIADHSILEGGARNSE
RKPTQIIFSLINGTTWYLKANMQSHKIQKLDLIKKLHSEVFKLNLNNSTIVFRTPREDQYQTLHIGNKSPHLTNNNTTHK
TVYNATGDAKIYFNTEWNNEVPKEQQKTDRLLIHGDVSGITTIHFRNLLKGKKTKEKNTGPVNTRGLSLVQVSGKAEENS
FKLANGYTTIKGLPYKYTLNAYGPTSSRGKASIEQSFVGEEEDFWDFRLQNAILDAEETISPDTQETNFFNSEEITPLNT
EETASLNDGETTPLYSKKAASPDAEETISSDTQETNFFNSEEITPLNTEETASLNDGETTPLYSKKAASPDAEETISSDT
QETNFFNSEEITPLNTEETASLNDGETTPLYSKKAASPDAEETISPDTQETNFFDSEEITPLNTEETASLNDGETTPLYS
KKAASPDAEETISSDTQETNFFNSEEITPLNTEETASLNDGETTPLYSKKAASPDAEETISPDTQETNFFDSEEITPLNT
EETASLNDGETTPLYSKKAASPDAEETISSDTQETNFFDSEEITPLNTEETASLNDGETTPLYSKKAACLNAKGKVRALV
PQVASYLVMPNALFSAGLAELNNQNILLENMRTTLFEAKDKKEDNKKSGIFLSSYGHKITLSSNRSPLHYGYGADVHYTA
IQAGMTLAALEGQNSTTHFGLLGTYGQLSFTPKGMEGADKSTLDKWSLAAYGNIQHNDGIYVNALFSYGAFKGNITTALI
GNTAKLDGSHTVSASATIGHKLETDAKGLVFEPQAQLLYQRLMLGTLSDIDGFNVNMGKPHQWLLRIGGRLTQTIPSDEK
GYATSFYGKLNLMKAFSNKSTVQIGDTFYLDAMGDSVEGGLGVNAQLSQNFALHADINYQHKLQKAGVSGINFSAGMRYQ
F